Protein Info for GFF476 in Variovorax sp. SCN45

Annotation: InterPro IPR005134 COGs COG2862

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details PF03350: UPF0114" amino acids 28 to 166 (139 residues), 121.2 bits, see alignment E=1.4e-39

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_2525)

Predicted SEED Role

"InterPro IPR005134 COGs COG2862"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF476 InterPro IPR005134 COGs COG2862 (Variovorax sp. SCN45)
MSAPDPFDTRNPPVPRRGSPLRPLPKLIFASRWLQLPLYLGLIVAQAVYVVHFLVELLHL
VEAAFGSKEALQALITSIGYKTTAPVGTLNETVIMLVVLALIDVVMISNLLIMVIVGGYE
TFVSRMDLEGHRDQPEWLSHVNASVLKVKLATAIIGISSIHLLKTFINADNYTDRVLIAQ
TVIHIAFLFSAMAIAYTDKLMTSSAPHGDDRH