Protein Info for GFF4759 in Variovorax sp. SCN45

Annotation: NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details PF00499: Oxidored_q3" amino acids 19 to 165 (147 residues), 133.8 bits, see alignment E=2e-43

Best Hits

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 89% identity to vpe:Varpa_4016)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF4759 NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3) (Variovorax sp. SCN45)
MDVKTGLFYLFAAVLLFAAFRVITSRNPVYAALYLVLAFFQASAIWLLLRAEFLAISLVL
VYVGAVMVLFLFVVMMLDINVDSLREGFWKHFPLAAGVGALIALEMAAVLMGGFRLGEAR
VTSGAMAADSSNTLELGKLLYSQYLYPLEIAAVILLVAIVAAIALTLRTRKDSKYTNPAD
QVRVKARDRVRIVQMPATRAAEPVAEAAPADAVKENKA