Protein Info for GFF4759 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 63 (26 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 437 to 459 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 12 to 270 (259 residues), 84 bits, see alignment E=1.3e-27 PF13440: Polysacc_synt_3" amino acids 27 to 318 (292 residues), 182.4 bits, see alignment E=1.2e-57

Best Hits

KEGG orthology group: None (inferred from 45% identity to adk:Alide2_0709)

Predicted SEED Role

"Polysaccharide biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>GFF4759 Polysaccharide biosynthesis protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LNIRKKIGLQFLVSNGATVANFALSVILARLLTPTDIGIFSMSAILITFAHVFRDFGVFS
YIVKEKEVTQQTIRTALGVLLVTSWTVAAILFFTSDVWSVFFKTPEVGDVVKVLAVGFVF
IPFGSIPYALLTRNLEVKRTSKVMAISVVTYFVTTIALAYTGHGHMTMAWANLVNIIVTG
AAYHLYSTTPMPWLPSLKGWKKITHFGTGTIVTSTVAALDAALPDVMLGKMSTPAAVGYF
SKAASAVSLPYTVLKSTIDYFALPYLSKLHHAQEDMAAAIQQASSYISVVIIPAMVWMTV
MDREIILFLFGPQWVASIDVIPWLCLTGAAGILFRLVTPALTSIGKPYAAAVPSLLVLLI
KVALAIVLFDGTLVSFGIAMAIGQIVGIPLYVMVNKVYFGLGVRQWLKGNVHIALIALIT
GAFSYVLKTYVHPNFPIFFSLLFNGIMFVAAWYVCVMLMKPPIEAELRRFQDSAAALLFK
KDAAG