Protein Info for GFF4758 in Variovorax sp. SCN45

Annotation: NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 30 to 151 (122 residues), 153.8 bits, E=7.4e-50
• PF00037: Fer4
  • amino acids 71 to 90 (20 residues), 24.1 bits, see alignment (E = 1.1e-08)
  • amino acids 107 to 128 (22 residues), 30.1 bits, see alignment (E = 1.4e-10)
• PF13237: Fer4_10
  • amino acids 71 to 124 (54 residues), 29.8 bits, E=2.3e-10
• PF12800: Fer4_4
  • amino acids 72 to 86 (15 residues), 17.2 bits, see alignment (E = 2.4e-06)
  • amino acids 111 to 125 (15 residues), 13.1 bits, see alignment (E = 5e-05)
• PF13187: Fer4_9
  • amino acids 73 to 126 (54 residues), 34.5 bits, E=7.8e-12
• PF12838: Fer4_7
  • amino acids 73 to 126 (54 residues), 44.8 bits, E=6.6e-15

Best Hits

Swiss-Prot: 88% identical to NUOI_VEREI: NADH-quinone oxidoreductase subunit I (nuoI) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 92% identity to vpe:Varpa_4017)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (173 amino acids)

>GFF4758 NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3) (Variovorax sp. SCN45)
MSAAHTATPSAPFSLKDFLGSFMLFELFKGLAITGKYAFARKITVQFPEEKTPLSPRFRG
LHALRRYENGEERCIACKLCEAVCPALAITIESEVRDDGSRRTSRYDIDLTKCIFCGFCE
ESCPVDSIVETHIFEYHGEKRGDLYFTKDMLLAVGDRYENEIAANKAADAKYR