Protein Info for GFF4757 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion inner membrane protein (YscQ,homologous to flagellar export components); Surface presentation of antigens protein SpaO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR02551: type III secretion apparatus protein, YscQ/HrcQ family" amino acids 30 to 295 (266 residues), 201.7 bits, see alignment E=1.3e-63 PF01052: FliMN_C" amino acids 227 to 296 (70 residues), 49.7 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 100% identical to SPAO_SALTY: Surface presentation of antigens protein SpaO (spaO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03225, type III secretion protein SctQ (inferred from 98% identity to sew:SeSA_A3044)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF4757 Type III secretion inner membrane protein (YscQ,homologous to flagellar export components); Surface presentation of antigens protein SpaO (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSLRVRQIDRREWLLAQTATECQRHGREATLEYPTRQGMWVRLSDAEKRWSAWIKPGDWL
EHVSPALAGAAVSAGAEHLVVPWLAATERPFELPVPHLSCRRLCVENPVPGSALPEGKLL
HIMSDRGGLWFEHLPELPAVGGGRPKMLRWPLRFVIGSSDTQRSLLGRIGIGDVLLIRTS
RAEVYCYAKKLGHFNRVEGGIIVETLDIQHIEEENNTTETAETLPGLNQLPVKLEFVLYR
KNVTLAELEAMGQQQLLSLPTNAELNVEIMANGVLLGNGELVQMNDTLGVEIHEWLSESG
NGE