Protein Info for PS417_24305 in Pseudomonas simiae WCS417

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 TIGR00416: DNA repair protein RadA" amino acids 1 to 450 (450 residues), 668.7 bits, see alignment E=2.1e-205 PF18073: Zn_ribbon_LapB" amino acids 8 to 35 (28 residues), 37.9 bits, see alignment (E = 2.7e-13) PF06745: ATPase" amino acids 79 to 148 (70 residues), 39.9 bits, see alignment E=8.3e-14 PF13481: AAA_25" amino acids 82 to 222 (141 residues), 47.6 bits, see alignment E=4e-16 PF13541: ChlI" amino acids 354 to 429 (76 residues), 31.4 bits, see alignment E=3.9e-11 PF05362: Lon_C" amino acids 370 to 431 (62 residues), 26 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 90% identical to RADA_PSEAE: DNA repair protein RadA (radA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to pfs:PFLU5337)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1M4 at UniProt or InterPro

Protein Sequence (455 amino acids)

>PS417_24305 DNA repair protein RadA (Pseudomonas simiae WCS417)
MAKAKRMYGCTECGATFPKWAGQCTECGAWNTLTETMIESGGAAAPTGRAGWTGQQAQIK
TLAEVSVEEIPRFSTASGELDRVLGGGLVDGSVVLIGGDPGIGKSTILLQTLCSIASRMP
ALYVTGEESQQQVAMRARRLGLPQDQLRVMTETCIESIIATARIEKPKVMVIDSIQTIFT
EQLQSAPGGVSQVRESAALLVRYAKQSGTAIFLVGHVTKEGALAGPRVLEHMVDTVLYFE
GESDGRLRLLRAVKNRFGAVNELGVFAMTDRGLKEVSNPSAIFLTRAQEEVPGSVVMATW
EGTRPMLVEVQALVDDSHLANPRRVTLGLDQNRLAMLLAVLHRHGGIPTHDQDVFLNVVG
GVKVLETASDLALMAAVMSSLRNRPLPHDLLVFGEVGLSGEVRPVPSGQERLKEAAKHGF
KRAIVPKGNAPKESPPGITIIGVTRLEQALDALFE