Protein Info for GFF4752 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion chaperone protein for YopD (SycD)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR02552: type III secretion low calcium response chaperone LcrH/SycD" amino acids 21 to 150 (130 residues), 128 bits, see alignment E=9.9e-42 PF07720: TPR_3" amino acids 37 to 70 (34 residues), 48.9 bits, see alignment 2.4e-17 amino acids 71 to 104 (34 residues), 46.2 bits, see alignment 1.8e-16

Best Hits

Swiss-Prot: 100% identical to SICA_SALTY: Chaperone protein SicA (sicA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to ses:SARI_00087)

Predicted SEED Role

"Type III secretion chaperone protein for YopD (SycD)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>GFF4752 Type III secretion chaperone protein for YopD (SycD) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDYQNNVSEERVAEMIWDAVSEGATLKDVHGIPQDMMDGLYAHAYEFYNQGRLDEAETFF
RFLCIYDFYNPDYTMGLAAVCQLKKQFQKACDLYAVAFTLLKNDYRPVFFTGQCQLLMRK
AAKARQCFELVNERTEDESLRAKALVYLEALKTAETEQHSEQEKE