Protein Info for GFF4751 in Variovorax sp. SCN45

Annotation: NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 11 to 152 (142 residues), 252.6 bits, see alignment E=5.2e-80 PF01058: Oxidored_q6" amino acids 37 to 145 (109 residues), 95.7 bits, see alignment E=9e-32

Best Hits

Swiss-Prot: 99% identical to NUOB_VARPS: NADH-quinone oxidoreductase subunit B (nuoB) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 99% identity to vap:Vapar_3509)

MetaCyc: 59% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>GFF4751 NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3) (Variovorax sp. SCN45)
MAIEGVLKEGFVTTTYDSVVNWAKTGSLWPMTFGLACCAVEMMHAGAARYDIDRFGMLFR
PSPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRWVLSMGSCANGGGYYHYSYSVVRGCD
RIVPVDVYVPGCPPTAEALLYGVIQLQQKIRRTNTIARA