Protein Info for GFF4748 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion injected virulence protein (YopE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 PF09052: SipA" amino acids 35 to 248 (214 residues), 358 bits, see alignment E=1.8e-111 PF22163: SipA_2nd" amino acids 505 to 640 (136 residues), 294.1 bits, see alignment E=1.6e-92

Best Hits

Swiss-Prot: 100% identical to SIPA_SALTY: Cell invasion protein SipA (sipA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13284, invasin A (inferred from 100% identity to seh:SeHA_C3072)

Predicted SEED Role

"Type III secretion injected virulence protein (YopE)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>GFF4748 Type III secretion injected virulence protein (YopE) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQTEIKTQATNLAANLSAVRESATATLSGEIKGPQLEDFPALIKQASLDALFKCGKDAEA
LKEVFTNSNNVAGKKAIMEFAGLFRSALNATSDSPEAKTLLMKVGAEYTAQIIKDGLKEK
SAFGPWLPETKKAEAKLENLEKQLLDIIKNNTGGELSKLSTNLVMQEVMPYIASCIEHNF
GCTLDPLTRSNLTHLVDKAAAKAVEALDMCHQKLTQEQGTSVGREARHLEMQTLIPLLLR
NVFAQIPADKLPDPKIPEPAAGPVPDGGKKAEPTGINININIDSSNHSVDNSKHINNSRS
HVDNSQRHIDNSNHDNSRKTIDNSRTFIDNSQRNGESHHSTNSSNVSHSHSRVDSTTHQT
ETAHSASTGAIDHGIAGKIDVTAHATAEAVTNASSESKDGKVVTSEKGTTGETTSFDEVD
GVTSKSIIGKPVQATVHGVDDNKQQSQTAEIVNVKPLASQLAGVENVKTDTLQSDTTVIT
GNKAGTTDNDNSQTDKTGPFSGLKFKQNSFLSTVPSVTNMHSMHFDARETFLGVIRKALE
PDTSTPFPVRRAFDGLRAEILPNDTIKSAALKAQCSDIDKHPELKAKMETLKEVITHHPQ
KEKLAEIALQFAREAGLTRLKGETDYVLSNVLDGLIGDGSWRAGPAYESYLNKPGVDRVI
TTVDGLHMQR