Protein Info for GFF4747 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details PF00892: EamA" amino acids 6 to 139 (134 residues), 37.9 bits, see alignment E=1.1e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF4747 membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTANRRAILLMLVFVFLWAGIEAMAANVLRHYSPYQVVWTRYAVHLALMAALWGWREPAS
LWQTRRPVFHVARSLLMLGMPASWVIGMQMGVSGHAVMTIFWISPLLILGLAWVFLQDRV
PLLVWVATGVACVGGLLVNGLHGLPGASLLIYPLGMALCFSAYVVMTRSLRTETTRTNLF
YTAAGVFVVLTPAMPGLWVMPSLPDLLVMVVIGLLGYVTLLALDRSAAAAPVSISAPFAY
LQIAFTVPLFWAAGLGHDMSLPRMALGLLLIVGAALCLWLREPRLNARDAVMARSTP