Protein Info for GFF4744 in Xanthobacter sp. DMC5

Annotation: Tn3 family transposase TnXax1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 37 to 341 (305 residues), 333.9 bits, see alignment E=4.4e-104 PF13406: SLT_2" amino acids 38 to 338 (301 residues), 285.4 bits, see alignment E=5.1e-89 PF01471: PG_binding_1" amino acids 359 to 413 (55 residues), 39 bits, see alignment 7.8e-14

Best Hits

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_3393)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF4744 Tn3 family transposase TnXax1 (Xanthobacter sp. DMC5)
MSRPLPAGCRCLLAGLIAWTLALSIAASAPARAADAAFAQFIASLWPEAQAAGVSRATFE
RETAGLEPDYKLPDLALPGRPSTGAGGQAEFVQVPAAYVKEATIARLAAEGQRLMQKYKA
PLDRIEAMFGVPAPVVLAIWGRETDFGRYTSPHDALKVLATQAYAGRRKDQYRTEFILAL
KMLNDGDVSRKDFRASWAGATGLTQFLPSDYVKHGVDLDGTGHADIWHSVPDALASAAKQ
LADKGWQPGVRWAYEVLAPVNADCTMGVPEFKQPIGEWIRARYAPVRRLSATEVAQPASL
LQPEGTYGPAFLTTANYFVIKQYNFSDLYVLFVGHLSDRMTDPSPFRTPWSASSQLKTKS
VEAMQKHLARMGLYSDKIDGKAGMQTRAALGAYQKSAGLKVDCWPSEAVLNAMNAGR