Protein Info for GFF4743 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Invasion protein IagB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01464: SLT" amino acids 20 to 137 (118 residues), 119.2 bits, see alignment E=3.6e-39

Best Hits

Swiss-Prot: 100% identical to IAGB_SALTS: Invasion protein iagB (iagB) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: None (inferred from 98% identity to stt:t2779)

Predicted SEED Role

"Invasion protein IagB precursor" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>GFF4743 Invasion protein IagB precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTD
LGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGT
SPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK