Protein Info for GFF4739 in Variovorax sp. SCN45

Annotation: N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 89 to 106 (18 residues), see Phobius details TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 4 to 318 (315 residues), 429.3 bits, see alignment E=8.3e-133 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 311 (308 residues), 364.4 bits, see alignment E=4.7e-113 PF00814: TsaD" amino acids 29 to 311 (283 residues), 315.8 bits, see alignment E=2.8e-98 PF22521: HypF_C_2" amino acids 233 to 307 (75 residues), 29.2 bits, see alignment E=8.1e-11

Best Hits

Swiss-Prot: 93% identical to TSAD_VARPS: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 95% identity to vpe:Varpa_4035)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF4739 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) (Variovorax sp. SCN45)
MLLLGIESSCDETGVALVESHGNALPVLRSHALHSQISMHQAYGGVVPELASRDHIRRVL
PLTESVMAEAGRSLGEIDVVAYTRGPGLAGALLVGAGVACALGVALGKPVLGVHHLEGHL
LSPFLSADPPEFPFVALLVSGGHTQLMRVDGVGRYELLGETIDDAAGEAFDKSAKLMGLP
YPGGPWLAKLAEDGNPAAFKLPRPLLHSGDLDFSFAGLKTAVLTQAKKLGDQLEANKADL
AASTQAAIVEVLLKKSLAALDQTGLKRLVVAGGVGANKNLREQLNAACARRKVRVHYPEL
HLCTDNGAMIAMAAAMRLQSGLSQATERYAFDVRPRWPMASLTAEASLPQAA