Protein Info for GFF4737 in Variovorax sp. SCN45

Annotation: Nitrate ABC transporter, substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13379: NMT1_2" amino acids 39 to 289 (251 residues), 341.5 bits, see alignment E=1.9e-106

Best Hits

Swiss-Prot: 38% identical to NRTA_NOSS1: Nitrate/nitrite binding protein NrtA (nrtA) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 97% identity to vpe:Varpa_4037)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>GFF4737 Nitrate ABC transporter, substrate-binding protein (Variovorax sp. SCN45)
MTDLLKTRLSRRRVLQAAAIGAVGIDPALRAAVWAQGSDKPEKEEVKIGFIPLTDCASVV
MASVLGIDKKYGVKIVPSKEASWAGVRDKLSNGDLDMAHVLYGLVYGMHLGLSGPRKDMA
VLMTLNNNGQAITLSKKLSDKGAVDAASLAKLIASEKREYTFAQTFPTGTHAMWLYYWLA
SAGIDPFKDVKNITVPPPQMVANMRVGNMDGYCVGEPWGQRAIMDGIGITAITTQDIWKD
HPEKVLGCTAEFTKKYPNTARAVTAAILEAGKWIDAGLQNKNKMAETIADKSYVNTSVDA
INQRILGRYTNGLGKSWDDPNHMKFYNGGAVNFPYLSDGMWFLTQHKRWGLLKEHPDYLK
VATEINRIDIYKQAAAATQTPVPKDPMRTSKLFDGSVWDGKDPKKYADSFKLHA