Protein Info for GFF4736 in Variovorax sp. SCN45

Annotation: Nitrate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 271 to 297 (27 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 96 to 289 (194 residues), 244.9 bits, see alignment E=3e-77 PF00528: BPD_transp_1" amino acids 130 to 290 (161 residues), 78.4 bits, see alignment E=3e-26

Best Hits

Swiss-Prot: 42% identical to CMPB_SYNY3: Bicarbonate transport system permease protein CmpB (cmpB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 94% identity to vpe:Varpa_4038)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF4736 Nitrate ABC transporter, permease protein (Variovorax sp. SCN45)
MVSAVFHSPLEASLPLPRAGEGRGEAAPHPNSLPKGEREQKQRTPIDLRAFWMRVLPPLA
GFGLLLLIWEIVAMKSTTGFPTPAATWQQALTVFSDPFYSKGPNDQGVGWNVLSSLQRVA
LGFGLAALVGIPAGFAIGRFEFLSRMFNPLISLMRPVSPLAWLPIGLLVFKGANPAAIWT
IFICSIWPMVINTAVGVQRVPTDYMNVAKVLNLSEWKILTKILFPSVLPYMLTGVRLAVG
TAWLVIVAAEMLTGGVGIGFWVWDEWNNLNVANIIIAIFVIGIVGLVLEFALIKLATAFT
FEEVKS