Protein Info for GFF4736 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 14 to 339 (326 residues), 89.2 bits, see alignment E=1.4e-29

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF4736 putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTESPSTASHRQPALDWLRGFAALIVVGFHYFHAGVRDGSIQGEQNPVLYSVFSYGYVGV
HLFFMISGYVIMMSAQHAGVRQFVASRVSRLMPAFWVCVSLTVLIELAAPAAPFKPESWA
QYAAHLTMVPRVFGQNLIDGAYWSLAVEINFYFWVGVAIATGQLKRIEMLLALWLCLSLV
NFIRPMYTVEVLTSAQWAPLFTAGAFFFLVRQSGWTPLRRWVLLGSAALACMYLWRENGQ
GESLQQLLALNVSPNNLVIEAILLSYFAFFLWMIRRPVPIRASRWSDLSGRLTYPLYLIH
QHAGYALFSVAAASGLIASWGMTLVTLGMIALALLVAWGVNVGVEQRLAPILRGWIAGGR
SVNNSAPRQKSARYAEPFADSA