Protein Info for GFF4733 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion transcriptional regulator HilC (= SirC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF12833: HTH_18" amino acids 215 to 291 (77 residues), 52.4 bits, see alignment E=5.4e-18

Best Hits

Swiss-Prot: 100% identical to SIRC_SALTS: Transcriptional regulator sirC (sirC) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: None (inferred from 99% identity to stt:t2769)

Predicted SEED Role

"Type III secretion transcriptional regulator HilC (= SirC)" in subsystem Type III secretion system orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF4733 Type III secretion transcriptional regulator HilC (= SirC) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVLPSMNKSVEAISNNHLQQPNKFPLINGLADVRDYYVANCLLFKLNKGSLRIENEFGEF
IERSAPCLFLLEKDQTITLSMSEIEGHIDFSSLEVSYDLMQKFYKVFYSTRNYNDRELSL
KTKPKYFFHADLLPGMSDTFDSILHGVACPRVCSNVSIDDHDYSYFSLMYLISAFVRKPG
GFDFLERAIKITTKEKVYNIIISDLTRKWSQAEVAGKLFMSVSSLKRKLAAEEVSFSKIY
LDARMNQAIKLLRMGAGNISQVATMCGYDTPSYFIAIFKRHFKITPLSFMRTMNH