Protein Info for GFF4730 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Manganese ABC transporter, inner membrane permease protein SitD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details PF00950: ABC-3" amino acids 11 to 266 (256 residues), 266.5 bits, see alignment E=2.6e-83 PF01032: FecCD" amino acids 58 to 270 (213 residues), 27.7 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 54% identical to Y359_HAEIN: Probable iron transport system membrane protein HI_0359 (HI_0359) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 99% identity to sek:SSPA2536)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF4730 Manganese ABC transporter, inner membrane permease protein SitD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFLTTLLEPFQFDFMVNALMVSVIVAIPCALLSVFLVLKGWALMGDAMSHAVFPGVVLAY
IVGIPLAIGAFIAGLFCAIATGYLDDNSRIKRDTVMGIVFSGMFGAGLVLYVSIQSEVHL
DHILFGDMLGVSLGDIVQTSVIALGIALIIGLKWKDLLLHAFDPHQAKASGLNTTLLHYG
LLCMIALTIVATLKSVGIILSISLLIAPGAIAILLTRRFARALGLAVSLSVITAFAGVYL
SFYLDSAPAPTIVVLFAIVFIAAFIYATWRDRRNEIVPEAQG