Protein Info for GFF473 in Xanthobacter sp. DMC5

Annotation: Leu/Ile/Val-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 5 to 35 (31 residues), 16.7 bits, see alignment (E = 3.6e-07) PF13458: Peripla_BP_6" amino acids 38 to 387 (350 residues), 204.1 bits, see alignment E=7.7e-64 PF13433: Peripla_BP_5" amino acids 39 to 117 (79 residues), 45.9 bits, see alignment E=6.7e-16 PF01094: ANF_receptor" amino acids 60 to 370 (311 residues), 60.5 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 64% identity to axy:AXYL_05215)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF473 Leu/Ile/Val-binding protein (Xanthobacter sp. DMC5)
VQFGRRSFLKMVPAAALAATGTGTVAGLWSSAARAAEPLRVGSILSVTGPAAFLGEDMKA
GLELAVDEFNAAGGMGGRKIEWTYYDAESQTQKGITATRRLISQDKVEVILSGGNMSGIA
LAMAPITNAAKVPFISSEGALAIVTPVAERQYVFKSTVDDGDVLERIADYLDKKKIKKVA
LIADTSGFGQGAVGQMKIVGPKRGLDVMYESFAPSDTDMMPQLTRIRDAGAEAIICWTVT
PAGVVFLKQAQQLGLDKKTLIHSYGFVSADYMKLAGDAANTLLLASLKLPVGDQLPDSDP
LKAGILKLMKAYEARFKRPASIYAAESYDAALLAREALKKVGGDVSKLSQGMEQIKDFPG
ISGVFTFSPERHSGLSKQDIVLVNWRDGRFNLADYA