Protein Info for PS417_02415 in Pseudomonas simiae WCS417

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF13740: ACT_6" amino acids 3 to 79 (77 residues), 92.6 bits, see alignment E=3.4e-30 PF01842: ACT" amino acids 6 to 65 (60 residues), 34.1 bits, see alignment E=5.6e-12 PF21086: ACT_PSP_2" amino acids 98 to 180 (83 residues), 37.6 bits, see alignment E=5.7e-13 TIGR00338: phosphoserine phosphatase SerB" amino acids 177 to 395 (219 residues), 267.1 bits, see alignment E=1.1e-83 PF00702: Hydrolase" amino acids 192 to 364 (173 residues), 87.2 bits, see alignment E=6e-28 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 192 to 362 (171 residues), 113.2 bits, see alignment E=1.4e-36 PF12710: HAD" amino acids 193 to 360 (168 residues), 95.9 bits, see alignment E=1.2e-30 PF08282: Hydrolase_3" amino acids 328 to 394 (67 residues), 43.1 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 98% identity to pfs:PFLU0504)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1B4 at UniProt or InterPro

Protein Sequence (404 amino acids)

>PS417_02415 phosphoserine phosphatase (Pseudomonas simiae WCS417)
MREIVLINITGEDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLSFGILVEIPSTEQASS
VLKDILFTAYKLDQQVRFTPVSEEDYQHWVAGQGKKRHIVTLLTRKVTAEQLQRVSSITA
QYGLNIDHIDRLSGRMPLDTPADQGKGCIEFSVRGEPADPQALRAEFLSVAQELNVDIAF
QEDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEQVAEITERAMAGELDFRASFKE
RLALLKGLDVSVLDSIGASLRLTEGAETLFAELKRLGYKTAILSGGFTYFAKQLQAKLGI
DYVFANELEVVDGKVTGMAVEPIVDAQRKADLLKELAHKEGLRLEQTIAVGDGANDLPML
AIAGLGVAFRAKPLVKQSAKQAISTLGLDGVLYLLGFRDRDGQL