Protein Info for GFF4729 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG071646: Sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 444 to 458 (15 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 19 to 463 (445 residues), 418.5 bits, see alignment E=4.2e-129 TIGR03013: sugar transferase, PEP-CTERM system associated" amino acids 31 to 463 (433 residues), 504.6 bits, see alignment E=3e-155 PF13727: CoA_binding_3" amino acids 66 to 215 (150 residues), 25.3 bits, see alignment E=1.4e-09 PF02397: Bac_transf" amino acids 275 to 458 (184 residues), 231.9 bits, see alignment E=4e-73

Best Hits

KEGG orthology group: None (inferred from 61% identity to adk:Alide2_1090)

Predicted SEED Role

"FIG071646: Sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>GFF4729 FIG071646: Sugar transferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
LIKLFNHYFDRRTLLQMFMDLLLISAAFMATLVILSDAEDLTAVQIGQGVFRALLMSMGF
LAVNSALGLYDRGSVFNNTQLRARVLVSFMMMGLIVVGVLLLLPMKAFYGHTWAVVIVMM
ATGLLLVIQVLTGELLPKSLTRRKVLVYGTGAKAQAVGENLRRASSSAELSGYFASPNER
EHVVTNWGTLEPGQSLTEVVAEKGVHEIVIALSERRGGSMPMRELLDCKLAGVRVTDIAT
YFEQHMGQIRLDAVSAGWLIFGEGFDQGFLRTTIKRLFDIAGAVVLILLALPIMLVAALV
IKLESSGPILYKQERVGLNNKPFNVVKFRSMRTDAEKDGIPRWATAGDSRVTRVGKVIRK
LRIDELPQLFSVLNGDMSLVGPRPERAFFVEKLTQEIPFYAVRHSVKPGVTGWAQVRYQY
GSTVEDTAEKLQYDLYYVKNHSLFLDLVVIFETVGVVLTGKGAQ