Protein Info for GFF4729 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Manganese ABC transporter, inner membrane permease protein SitC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 123 to 151 (29 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details PF00950: ABC-3" amino acids 10 to 264 (255 residues), 273 bits, see alignment E=2.8e-85 PF01032: FecCD" amino acids 63 to 258 (196 residues), 39.4 bits, see alignment E=3.9e-14

Best Hits

Swiss-Prot: 67% identical to YFEC_YERPE: Chelated iron transport system membrane protein YfeC (yfeC) from Yersinia pestis

KEGG orthology group: K11605, manganese/iron transport system permease protein (inferred from 99% identity to sek:SSPA2535)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitC" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF4729 Manganese ABC transporter, inner membrane permease protein SitC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNWLVEPFGYQYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGDALSHSIVPGVAGAWML
GLPFSLGAFLSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFFGVGLFMVSLNPMSVNIQT
IILGNVLAIAPADIAQLAIIGAVSLTILLLKWKDLMVVFFDETHARSIGLNPGRLKLLFF
TLLSVSTVAALQTVGAFLVICLVVTPGATAWLLTDRFPRLLMIAVVIGSLTSFLGAWLSY
WLDGATGGIIVVMQTLLFITAFIFAPKHGLLANRRRARLQKEPTCS