Protein Info for GFF4723 in Xanthobacter sp. DMC5

Annotation: Multidrug resistance ABC transporter ATP-binding/permease protein BmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 26 to 600 (575 residues), 861.2 bits, see alignment E=2e-263 PF00664: ABC_membrane" amino acids 48 to 309 (262 residues), 162.1 bits, see alignment E=2.3e-51 PF00005: ABC_tran" amino acids 382 to 529 (148 residues), 109.9 bits, see alignment E=1.6e-35

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 86% identity to xau:Xaut_0844)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase and permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (604 amino acids)

>GFF4723 Multidrug resistance ABC transporter ATP-binding/permease protein BmrA (Xanthobacter sp. DMC5)
LTQADTSSAPVDSSETRAAAEKRRRDLKPLAGLAPYLKRYRGRVAAALGALLAAALATLA
LPIAVRRMIDFGFAEDHAGLVDQYFGVLVAVAAVLALASAARYYLVTTLGERVVSDLRTA
VFARLVTLDGAFYDSARSGELTSRLTADTTQLKSAVGASASTALRNLMMCIGSVAMMVVT
SPRLSGLVLVAIPIIVLPLMASGRKVRRLTRQAQDTLADASAYAAEALNSMRALQAASAE
GVARQRFDGAVEEAFGAARQATQARGWLTGIAIFLVFGSVVAVLWAGAQSVLAGTMTSGA
LGQFVLYAVLAAASLGNLSETWGEMSAAAGAAERIGELLKVEPQVRPPARPVPLPARISG
AIRFDEVSFSYPTRPDQSALAAIAFSIRPGERVALVGPSGAGKSTVFQLLERFYDPQAGR
ILLDGIDIREADPVAVRRQMALVPQEVAIFADSVRANIRLGRPEATDAEVEEAGRAALVD
EFVARLPQGWDTMVGERGVMLSGGQRQRIVIARAILRGAPILLLDEATSALDAESETLVQ
TALERSMEGRTTLVIAHRLSTVLSADRILVMEAGRIMDEGTHAELVAKGGLYARLAQLQF
HAAA