Protein Info for GFF4720 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: [NiFe] hydrogenase nickel incorporation protein HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00100: hydrogenase nickel insertion protein HypA
  • amino acids 1 to 114 (114 residues), 139.3 bits, E=2.9e-45
• PF01155: HypA
  • amino acids 1 to 113 (113 residues), 107.4 bits, E=2.2e-35

Best Hits

Swiss-Prot: 100% identical to HYPA_SALTI: Hydrogenase maturation factor HypA (hypA) from Salmonella typhi

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 100% identity to sed:SeD_A3164)

MetaCyc: 87% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (9/10 steps found)

Protein Sequence (118 amino acids)

>GFF4720 [NiFe] hydrogenase nickel incorporation protein HypA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHEITLCQRALELIEQQASAYGAKRVTAVWIKIGAFSCVETSALSFCFDLVCRGTIAEGC
KLHLEEQEAECWCEHCQQYVTLLTHRVRRCPQCHSDTLRIVADDGLQIRRIEIDETED