Protein Info for GFF4718 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Formate hydrogenlyase regulatory protein HycA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF11046: HycA_repressor" amino acids 1 to 146 (146 residues), 286.9 bits, see alignment E=2e-90

Best Hits

Swiss-Prot: 89% identical to HYCA_SHIFL: Formate hydrogenlyase regulatory protein HycA (hycA) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to spq:SPAB_03548)

Predicted SEED Role

"Formate hydrogenlyase regulatory protein HycA" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>GFF4718 Formate hydrogenlyase regulatory protein HycA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHAMSCAPERDLCFVLFE
HFRIYVALADGFNSHTIEYYVETKDGEDKQLIAQAQLDIDGKVDERVNNRDREQVLEHYL
EKIASVYDSLYTAVETNSPVNLRQLVKGHSPAV