Protein Info for GFF4717 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 58 to 85 (28 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 205 to 221 (17 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 58 to 154 (97 residues), 96 bits, see alignment E=8e-32 PF00528: BPD_transp_1" amino acids 77 to 254 (178 residues), 79.6 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 78% identity to vap:Vapar_5591)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF4717 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MDLEDPSSEPRRRSRLGSAVLVVCVLAGIWVAVRHFSGGASGTAYDWDFGVLWSYRRLLL
IGLAYTLVFTVVCVVLGLAIGLITGLGRLSRNPWISAPIRAYIEVFRCTPVLVQLVWFYY
ALPVLTGLEISAVAAATLCLSLYGGAFYSEIVRGGIISIDNGQVEAARALGMTRMQLMRR
IVLPQAFKRMVPPLMSQSIMQLKNTSLLSVLAVPDLLYQGQVIAHETYRPLELYTFIAVA
YFAVLLPVTIWAKRMELGAGPKEEA