Protein Info for GFF4717 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Formate hydrogenlyase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 47 to 97 (51 residues), 32.7 bits, E=2.4e-11
• PF00037: Fer4
  • amino acids 76 to 98 (23 residues), 28.4 bits, see alignment (E = 3.8e-10)

Best Hits

Swiss-Prot: 96% identical to HYCB_ECOL6: Formate hydrogenlyase subunit 2 (hycB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to cro:ROD_30871)

MetaCyc: 96% identical to hydrogenase 3 iron-sulfur protein HycB (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 2" in subsystem Formate hydrogenase

MetaCyc Pathways

• mixed acid fermentation (16/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production V (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Protein Sequence (202 amino acids)

>GFF4717 Formate hydrogenlyase subunit 2 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VNRFVIADSTLCIGCHTCEAACSETHRQHGLQSMPRLKVMLNEKESAPQLCHHCEDAPCA
TVCPVNAINRVDGAVQLNESLCVSCKLCGIACPFGAIEFSGSRPLHIPANANTPKAPPAP
PAPARVSTLLDWVPGVRAIAVKCDLCSFDEQGPACVRMCPTKALHLVENTDIARASKRKR
ELTFNTDFGDLTLFQQAQSGDA