Protein Info for GFF4716 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Formate hydrogenlyase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 58 (26 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 130 to 146 (17 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 316 to 318 (3 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details amino acids 455 to 480 (26 residues), see Phobius details amino acids 500 to 521 (22 residues), see Phobius details amino acids 586 to 605 (20 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 124 to 401 (278 residues), 130 bits, see alignment E=5.4e-42

Best Hits

Swiss-Prot: 89% identical to HYCC_ECOLI: Formate hydrogenlyase subunit 3 (hycC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to cko:CKO_04078)

MetaCyc: 89% identical to hydrogenase 3 membrane subunit HycC (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 3" in subsystem Formate hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>GFF4716 Formate hydrogenlyase subunit 3 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSSLSLITSGVAWFAAAAVLAFLFSFHKALSGWIAGIGGAVGSLCTAGAGFTALTSAVTV
SGVMPFTGHMLQITPLNAIWLITLGLCGLFVSLFNIDWHRHPQVKANGLLINLLMAAAVC
AVVASNLGTMVVMAEIMALCAVFLTGGSKEGKLWFALGRLGTLLLAIACWLVWQRYGTLD
LGLLDQRAQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAHANASAPAAALFSTVVMKI
GLLGILTLSLLGGNAPLWWGVALLVLGMITAFVGGLYALMEHNIQRLLAYHTLENIGIIL
LGLGAGVTGIALNQPVLIALGLTGGLYHLLNHSLFKSVLFLGAGSIWFRTGHRDIEKLGG
IGKRMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFFKLGNSGAFVGRLLGPLLAVGL
AITGALAVMCMAKVYGVTFLGAPRTKEAENASCAPILMGVSVVALAICCVLGGVAAPWLL
PMISTAVPLPLETAHTTVSQPMITLLLVACPLLPFIIMAMFKGNRLPSRSRGAAWVCGYD
HEQSMVITAHGFAMPVKEAFAPVLKLRKWLNPVSLIPGWQNAAAAVLFRRLALIELAVLV
VIVVSRGA