Protein Info for GFF4711 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acetate kinase (EC 2.7.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00016: acetate kinase
  • amino acids 2 to 391 (390 residues), 333.6 bits, E=7.4e-104
• PF00871: Acetate_kinase
  • amino acids 2 to 385 (384 residues), 341.6 bits, E=2.5e-106

Best Hits

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 73% identity to del:DelCs14_5783)

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

• Bifidobacterium shunt (12/15 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate IV (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• pyruvate fermentation to acetate and lactate II (2/4 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• methanogenesis from acetate (2/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (3/9 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.1

Protein Sequence (404 amino acids)

>GFF4711 Acetate kinase (EC 2.7.2.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVLVLNAGSSSIKFALFDASGPTLPREPAWKGQVRGIAGPQPTTADTDTPETALALDPAQ
PYHEALAHILRRVRAHLGETPLRAVAHRVVHGGSQYFDPVCVDAAVLADLQRYIPLAPLH
QPFALDAIQVLLASDPQLPQVACFDTAFHHTLPQVEQMLPLPYAAWERGLRRYGFHGLSY
EYLSVALPERHGELARGRVIAAHLGSGASLCGLQGLRSVATTMGFSALDGLMMGTRTGSL
DPGAVIYLMEIEKLSLEDVGRVLYHESGLLGVSGVSSEPRRLFAEEGRDDLTGERVRAAL
ALYVRRIVREIGALVAVLGGLDLLVFTAGVGEHSAEMRRRICRDLGFLGLALDDTANEAN
AALISAPGSAVAVAVEPTNEEWIAARHAAALVLSPPGAPPGAAP