Protein Info for GFF4707 in Xanthobacter sp. DMC5

Annotation: Galactose-proton symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 1 to 435 (435 residues), 373.7 bits, see alignment E=6.7e-116 PF00083: Sugar_tr" amino acids 6 to 437 (432 residues), 375.3 bits, see alignment E=6.8e-116 PF07690: MFS_1" amino acids 11 to 382 (372 residues), 110.8 bits, see alignment E=1.1e-35 PF06609: TRI12" amino acids 24 to 198 (175 residues), 29.8 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 86% identity to xau:Xaut_0824)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>GFF4707 Galactose-proton symporter (Xanthobacter sp. DMC5)
MIYLIAAIAGLAGALFGFDEGVIAGALAPLRRDLGIDPVAEGMMTAAVPFGAFIGAIVGG
RLAAAAGRRKLLLWSAILFIGGALLSALAGGLITLTLARLVIGLAVGVAAMMAPLYISES
APAKERGMLVSIYQLAITLGILGAYVVGYAFHENWRWMFAMGAVPAVLLFGGIFALSDTP
RWLAMRGRSAEAKAALARMREKPESDPSVAAEYEEIRAAAAADEGRKATFADLLSPRVRP
ALIVAMGLFLLQQLSGINAVIYYAPTVFELSGFSSTTTQILATAGIGVVNVLMTVVGMML
IDRLGRRLLLLIGFTGTAVSLGAIAIAAATGSPSLGVLALAGLVLYIASFAIAIGPLPWV
MMSEVFPLDCRALGMSIASLVNWGFNFIVVFSFPVLVAEFGLAGVFGLYAVVCVAGLAFT
QWLVPETNGVSLEEIERHLRSGRPLRELGRLHAA