Protein Info for GFF4706 in Variovorax sp. SCN45

Annotation: Na(+) dependent transporter,Sodium Bile acid symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details PF13593: SBF_like" amino acids 18 to 290 (273 residues), 65.5 bits, see alignment E=5.2e-22 PF01758: SBF" amino acids 21 to 202 (182 residues), 113 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 91% identity to vpe:Varpa_4063)

Predicted SEED Role

"Na(+) dependent transporter,Sodium Bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF4706 Na(+) dependent transporter,Sodium Bile acid symporter family (Variovorax sp. SCN45)
MLPVDEIRLHFNPASLVLLNVVLGFLMFGIALDTRIEDFKRVARMPGAMAVGIGAQFVVL
PAVTFALTLILKPGPSIALGMILVACCPPGNISQILTHRARGNVALSVSMTAISNAISIV
VMPLNFAFWGGLHPSAAPLLKTIALDPLDMLGHIVMIIGIPFVLGVACSHRLPALTARIK
KPVGAVSFIALIVFIVGAIAGNWRFFLDYVGLVLLAVVIHDALAFGTGYLCARLSGLGDY
DRRAVAIEVGIRNSGLGLVLIFSFFGGLGGMAVVAGVWGFWDIIAGLALAGWWGRRPVKP