Protein Info for GFF4706 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details amino acids 233 to 259 (27 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 31 to 375 (345 residues), 165 bits, see alignment E=2.7e-52 PF01061: ABC2_membrane" amino acids 224 to 345 (122 residues), 61.7 bits, see alignment E=7.8e-21

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 44% identity to pcr:Pcryo_1037)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>GFF4706 ABC-type multidrug transport system, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAQPSPGPAGLIGSFVATWRAMLGDVGAIMLLFVGGIVYSFFYPLPYSRESVQQVPVAV
VDQDLSAISRQITRYVAAHPAVDTQRVTPDLREAQDLLWKNEIAGVLMIPQGLESKVLSG
RRAEVDISGNGVYMMMNKVALNGLAEAVGTVSAGIELKRLAAGTPSPAQAMAQRQPVNVN
AVALFNVREGYGAYIVPGVAVLIIQQTLLLAITLLFGTWRERGAFPVRRSSAAYFGMLLA
FATVAFANSLYFFGFVLWWQDYPRAGNFGGLLLFAALFALCVAALGMLLGSLFRTRERSV
QLLLCTALPFMFLSGLSWPVEALPPALQALRWLVPSTAGVQGFIALNQLGASLAQVATEA
AALGAVFVFSAVVGLWRWRAEGRLVSSKV