Protein Info for GFF4703 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: OpgC protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 21 to 37 (17 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details PF10129: OpgC_C" amino acids 15 to 371 (357 residues), 242.7 bits, see alignment E=2.9e-76

Best Hits

KEGG orthology group: None (inferred from 61% identity to mpt:Mpe_A0354)

Predicted SEED Role

"OpgC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF4703 OpgC protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LRGGAGPITMSQNDRQWELDAMRGLMLVLMTLTHLPTKLADPLGQPLGYVSAAEGFVLLS
AYMAGRVYSAKADRQGTEAMKSAFFNRALKLYACQLALVLFAFTAIAGLGLALREGAVTD
LLSFFLERPVVATLSAGLLLYSPALLDILPIYIVFMLVSPLLLLHGREHGWRGVIALSLA
LWFGAQFGLGPALYQLAFGWFDMPVRYRDMGAFEIFAWQFLWTLGLWMGTEHSRPDPAPT
HFPRWMVRTALALAACAFLWRHAVGQTPMPDGSAVNLMFDKWHLGPLRLINLLALLVLAM
HFGPWLERHLPRWRPLETLGQAALPVFCAHLVMALLALAMFGAANAARPWSVDLLILFVG
FYTLWVVARLSSSGAAR