Protein Info for GFF4699 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 98% identical to SRLD_ECOLI: Sorbitol-6-phosphate 2-dehydrogenase (srlD) from Escherichia coli (strain K12)

KEGG orthology group: K00068, sorbitol-6-phosphate 2-dehydrogenase [EC: 1.1.1.140] (inferred from 100% identity to stt:t2736)

MetaCyc: 98% identical to sorbitol-6-phosphate 2-dehydrogenase (Escherichia coli K-12 substr. MG1655)
Sorbitol-6-phosphate 2-dehydrogenase. [EC: 1.1.1.140]

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

superpathway of hexitol degradation (bacteria) (18/18 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
D-sorbitol degradation II (1/1 steps found)
L-sorbose degradation (1/2 steps found)

KEGG Metabolic Maps

Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF4699 Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNQVAVVIGGGQTLGAFLCRGLAEEGYRVAVVDIQSDKAANVAQEINADFGEGMAYGFGA
DATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCA
REFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVH
SLMLGNLLKSPMFQSLLPQYATKLGIKPDEVEQYYIDKVPLKRGCDYQDVLNMLLFYASP
KASYCTGQSINVTGGQVMF