Protein Info for PS417_24035 in Pseudomonas simiae WCS417

Annotation: transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF03449: GreA_GreB_N" amino acids 5 to 74 (70 residues), 94.4 bits, see alignment E=4.1e-31 TIGR01462: transcription elongation factor GreA" amino acids 5 to 155 (151 residues), 174.8 bits, see alignment E=6.3e-56 PF01272: GreA_GreB" amino acids 83 to 156 (74 residues), 94.4 bits, see alignment E=3.2e-31

Best Hits

Swiss-Prot: 88% identical to GREA_PSESM: Transcription elongation factor GreA (greA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 95% identity to pfs:PFLU5264)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC76 at UniProt or InterPro

Protein Sequence (158 amino acids)

>PS417_24035 transcription elongation factor GreA (Pseudomonas simiae WCS417)
MTKYPMTVQGFKALEEEHAHLTKVVRPKLSQDIGTARELGDLKENAEYHAAREQQGMVEA
RIRDIEGRLQNSVVIDVTTIPKTGKVIFGTTVEIANVETDESVVYHIVGEDEADFKLGKI
SVGSPLARALIAKEEGDVVSVKTPGGVTEYEIVEVRHV