Protein Info for GFF4698 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, glucitol/sorbitol-specific IIA component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF03829: PTSIIA_gutA" amino acids 4 to 114 (111 residues), 128.6 bits, see alignment E=5.3e-42

Best Hits

Swiss-Prot: 82% identical to PTHA_SHIFL: PTS system glucitol/sorbitol-specific EIIA component (srlB) from Shigella flexneri

KEGG orthology group: K02781, PTS system, glucitol/sorbitol-specific IIA component [EC: 2.7.1.69] (inferred from 98% identity to sei:SPC_2875)

MetaCyc: 82% identical to sorbitol-specific PTS enzyme IIA component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-169 [EC: 2.7.1.198]; TRANS-RXN-156 [EC: 2.7.1.198, 2.7.1.197]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.197 or 2.7.1.198 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>GFF4698 PTS system, glucitol/sorbitol-specific IIA component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSVIYQTTITRIGQSAKEALGEQMLITFREGAPADIEEFCFIHCHGELTGALQPGARCEL
GQHCYPVTAVGSVAEQNLRELGHITLRFDGLREAEFPGTVHVAGPVPDDIAPGCILTFVA