Protein Info for GFF4697 in Variovorax sp. SCN45

Annotation: TldE protein, part of TldE/TldD proteolytic complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 254 to 270 (17 residues), see Phobius details PF01523: PmbA_TldD_1st" amino acids 43 to 102 (60 residues), 48 bits, see alignment E=1.7e-16 PF19290: PmbA_TldD_2nd" amino acids 130 to 236 (107 residues), 75.6 bits, see alignment E=5.9e-25 PF19289: PmbA_TldD_3rd" amino acids 244 to 455 (212 residues), 218.9 bits, see alignment E=7.3e-69

Best Hits

KEGG orthology group: K03592, PmbA protein (inferred from 98% identity to vpe:Varpa_4073)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>GFF4697 TldE protein, part of TldE/TldD proteolytic complex (Variovorax sp. SCN45)
MTTSSSRADSGFAYSRSFFENLVDTALAHAKKLGATDAGAEASEGCGLSVSVRKGELENV
ERNRDKSLGITVYVGHRRGNASTSDFSEGAIKQTVQAAYDIARFTAEDPVSGLPDEEDIA
KDHPELDLFHPWDVTSEQAAKLALECEAAALSTDKRITNSEGAGVSAQQSHFFSAHTHGF
RGGYASSRHSISVAPIAGKGDGMQRDAWYSSMRSADELASPQAVGRYAAERALSRLKSRK
IKTTECPVLFESPLAVGLLGGLVQAVSGGALYRKSSFLLDSLGKPVLPKHVDVAEDPHVM
RGKGSSPFDDEGVITRARKVVDAGRLEGYFLSTYSARKLGMKTTGNAGGSHNLTLSSRLT
KHTDDLDAMLAKLGTGLFVIELMGQGVNYVTGDYSRGASGFWVEKGKIAFPVQEITIAGN
LKDMLMGIEAIGADAYTFGAKTTGSVLVNRMKVAGA