Protein Info for GFF4693 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 120 (109 residues), 62.9 bits, see alignment E=1.7e-21 PF00528: BPD_transp_1" amino acids 35 to 228 (194 residues), 63.5 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: K10023, arginine/ornithine transport system permease protein (inferred from 80% identity to rfr:Rfer_1523)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>GFF4693 Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKWEVIFQPANLAMYGEGLITTVWLLLSSLGVGAVLALLFALALTSSIAPLRWIVGAYTY
VIRGTPLLIQLYLIYYGLAQLDWIQARWNDVWPWTHFKEPFFCALLAFSLNTAGYTAEML
AGAIRETAAGEIEAAQAMGMSPAMAMRRIVLPSAMRRTLPAYSNEVVMMLHATSLASTVP
AMLDVTAAASRIYSDYYLPFEAYIFAAAIYLTITFSLVGMFKLAERRFLAHLAPRGH