Protein Info for GFF4692 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 44 to 70 (27 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 6 to 114 (109 residues), 65.2 bits, see alignment E=3.2e-22 PF00528: BPD_transp_1" amino acids 27 to 219 (193 residues), 76.1 bits, see alignment E=1.6e-25

Best Hits

Swiss-Prot: 51% identical to HISQ_SALTY: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10024, arginine/ornithine transport system permease protein (inferred from 81% identity to rfr:Rfer_1524)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF4692 Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
LSGYFASILQGALLTVGVSLAALVVAILLGLLGAVAKLSGRPLLVGVATVYTTLVRGIPE
LVLMLLIFYGGTIGLNHLLAATGSKSSVDINPFLAGVLTIGFIYGAYMTETFRGAILSIP
KGQMEAAWAFGMGPVRTFMRITAPQMVRYALPGFTNNWLVLIKATALISLIGLKEMTYLA
KQASAATREPFTFFLFAAALFLIYTSVSLWALRRLERRFSLGVKRAHT