Protein Info for GFF4692 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Regulatory protein RecX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF02631: RecX" amino acids 49 to 163 (115 residues), 112.4 bits, see alignment E=9.2e-37

Best Hits

Swiss-Prot: 100% identical to RECX_SALTY: Regulatory protein RecX (recX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03565, regulatory protein (inferred from 98% identity to seh:SeHA_C3014)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>GFF4692 Regulatory protein RecX (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSEPTSRRPAYARLLDRAVRILAVRDHSEQELRRKLSAPVMGKNGPEEIDATADDYERVI
AWCHEHHYLDDERFVMRFIASRSRKGYGPARIRQELNQKGISRESTEKAMRECEIDWSEM
AREQAVRKYGEPLPSNFSEKVKVQRFLLYRGYLMDNIQQIWRNFAD