Protein Info for GFF4691 in Variovorax sp. SCN45

Annotation: Cobalt/zinc/cadmium resistance protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 12 to 288 (277 residues), 302.4 bits, see alignment E=1.5e-94 PF01545: Cation_efflux" amino acids 18 to 207 (190 residues), 156.9 bits, see alignment E=2.9e-50

Best Hits

Swiss-Prot: 42% identical to CZCD_BACVZ: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 65% identity to har:HEAR1602)

MetaCyc: 41% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF4691 Cobalt/zinc/cadmium resistance protein CzcD (Variovorax sp. SCN45)
MAHEHSHAAGSNEKALRWALLLTSAYLVAEVVGGLVSGSLALLSDAAHMFTDTVALAISL
AAIWIGKRPADRRRTFGYYRFEILAAVLNAVLLFFVAIYVLYEAYRRISAPAEIQSTMML
LVAVGGLVVNLIGMRLLASGKDKSLNVKGAYLEVWADMLGSIGVIVGALVIRFTGWAWVD
SVIAVAIGLWVLPRTWRLLRESLNVLLEGVPDDVDLQEVERALLASEGVASLHDLHVWAL
SSGKVSLSVHVVGTPDVGDLAPLTLRLRALLAQRFDIHHSTVQAERVPCEQAADSHGFGP
AAA