Protein Info for GFF4689 in Variovorax sp. SCN45

Annotation: Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein CzcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 137 to 439 (303 residues), 161.5 bits, see alignment E=1.3e-51 PF25973: BSH_CzcB" amino acids 162 to 305 (144 residues), 110.2 bits, see alignment E=9.6e-36 PF25917: BSH_RND" amino acids 162 to 297 (136 residues), 27.4 bits, see alignment E=6.1e-10 PF25893: HH_CzcB" amino acids 201 to 260 (60 residues), 91.6 bits, see alignment E=6.1e-30 PF25954: Beta-barrel_RND_2" amino acids 308 to 383 (76 residues), 52.7 bits, see alignment E=9.8e-18 PF25975: CzcB_C" amino acids 390 to 450 (61 residues), 94.1 bits, see alignment E=9.9e-31

Best Hits

KEGG orthology group: None (inferred from 82% identity to vpe:Varpa_4079)

MetaCyc: 51% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF4689 Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein CzcB (Variovorax sp. SCN45)
MNTQNRGSFTERVGKKQWMAIVIVLVVGLGAGAMILRSGPGKPEAAGHSEEAGHGDGEHH
EEGKKEGKAQAKEEGKDHDHDHGEAKGHADKEHHEEGKQEGKQAAASGEAKKEHAGHEEE
EEKIAFTDAQIKAADMTIENAGPARIKSSLQLPGEIKFNEDRTAHVVPRVAGVVDSVSAN
LGQEVKRGQVLAVISSPALSEQRSELQSAQRRLALARTTYVREKTLWEEKISPQQDYLQA
QQVMQEAQIAVANANQKLLALGATPSSSALGRYELRAPFDGMVVEKHISLGESVGEAVNV
FTISDLSTVWAEISVAANNLNLVRIGEPVSIRSSALGQTATGKVSYVGSLIGAQTRTATA
RVTLTNPQRVWRPGLFVNVELVASEVDAPVTVSTEAVQTVEDKPTVFLRVPGGFVPQHVQ
TGRSDGQRIEITSGLKPGAAYAASGSFVVKSQQGKSSATHTH