Protein Info for GFF4687 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage tail assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF14464: Prok-JAB" amino acids 4 to 94 (91 residues), 48.9 bits, see alignment E=5.9e-17 PF00877: NLPC_P60" amino acids 109 to 222 (114 residues), 50.6 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 77% identical to TIPK_LAMBD: Tail tip assembly protein K (K) from Escherichia phage lambda

KEGG orthology group: None (inferred from 100% identity to stm:STM1046)

Predicted SEED Role

"Phage tail assembly protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF4687 Phage tail assembly protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MINDDILAHARQCAPAESCGYVVRTAQGERYFPCENLSAEPTMYFRISPEDYLNARNRGD
IVALVHSHPDGKPCLSSADRTLQIQSGLDWWLVCDNRIHKFRCVPHLTGRQFEHGVTDCY
TLFRDAYHLAGIDMPDFDREDDWWSQGKSLYLDHLEAAGFYRVNPEDAQPGDVLICCFGS
PTPNHAAIYCGNGELLHHIPEQLSKREGYNDKWQRRTHSIWRHRQWCESAFTGIYNDLES
ASASA