Protein Info for GFF4686 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 17 to 71 (55 residues), 31.7 bits, E=1.7e-11
• PF13085: Fer2_3
  • amino acids 47 to 86 (40 residues), 28 bits, 2.8e-10
• PF01799: Fer2_2
  • amino acids 84 to 156 (73 residues), 106 bits, E=1.3e-34

Best Hits

Swiss-Prot: 43% identical to NDSFS_EUBBA: Nicotinate dehydrogenase small FeS subunit (ndhS) from Eubacterium barkeri

KEGG orthology group: None (inferred from 65% identity to rpb:RPB_4413)

MetaCyc: 53% identical to 4-hydroxybenzoyl-CoA reductase, gamma subunit (Aromatoleum aromaticum EbN1)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• ureide biosynthesis (5/7 steps found)
• 4-coumarate degradation (anaerobic) (4/6 steps found)
• 4-ethylphenol degradation (anaerobic) (4/6 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• phenol degradation II (anaerobic) (1/4 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (6/27 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.1.7.1 or 1.17.1.4

Protein Sequence (171 amino acids)

>GFF4686 Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNDSSSHEFPLTRVDMTLNGQPTSVDVEPRDMLIDVLRDRLRLKGTKRSCDVQVCGACTV
LVDGMPASSCTTLCSDVHERSVTTIEGVAAGGRLDPVQRAFIAHGALQCGFCTPGMILAV
KSLLAVDPRPTEDTVRHYLRGNLCRCTGYVKIIEAILDLAHHPERFSSEQQ