Protein Info for GFF4685 in Variovorax sp. SCN45

Annotation: Copper sensory histidine kinase CusS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 115 to 439 (325 residues), 346.8 bits, see alignment E=1.1e-107 PF00512: HisKA" amino acids 224 to 289 (66 residues), 54.7 bits, see alignment E=8.4e-19 PF02518: HATPase_c" amino acids 333 to 439 (107 residues), 77 bits, see alignment E=1.5e-25

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 83% identity to vpe:Varpa_4083)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>GFF4685 Copper sensory histidine kinase CusS (Variovorax sp. SCN45)
MSQPPGRPHSIQSRLSLWIAAQTLFGLSVICLAIYLVTAWNFDQKQEEELDHKAVLVQHL
LKEAEKGGNLPFLRHKLDDFFSMQDDVTLSISHAGQTLFQSTPAVGGIWMLRDIEVPWTQ
GDTTTQLSVQIGVNTAQEARLLRRLAWTLLGAVVLGTALVSFTGMWLVRRGLRPLKRLAE
STAAMAPDKANRPIDAMGFAEELRPWITQFNALLLRVQRAYVQLESFNADVAHELRTPLA
NLIGSTELALTRQRSNEELQAVLASNLEEIGRLSGIVTDMLFLSQAERGTPMRTRAVTSL
AVQAADVIDFYDAMLEEAGLRAEVTGDAMADVDTALIRRALFNLLGNAIRFATPASVIRI
EIGQDSGEFTVAVVNRGEPIDPAALPRLFERFYRAAQARDGSTRHHGLGLSIVEAIARMH
GGRVFAASQGGETRIGFTLLRS