Protein Info for GFF4684 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Attachment invasion locus protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF06316: Ail_Lom" amino acids 2 to 115 (114 residues), 32.4 bits, see alignment E=7.8e-12 amino acids 124 to 151 (28 residues), 23.7 bits, see alignment 3.7e-09 PF13505: OMP_b-brl" amino acids 12 to 163 (152 residues), 51.1 bits, see alignment E=1.9e-17

Best Hits

Swiss-Prot: 36% identical to AIL_YEREN: Attachment invasion locus protein (ail) from Yersinia enterocolitica

KEGG orthology group: None (inferred from 99% identity to sed:SeD_A1418)

Predicted SEED Role

"Attachment invasion locus protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>GFF4684 Attachment invasion locus protein precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKIVVAVLVGLALGSIGVANAAGYKNTVSIGYAYTDLSGWLSGNANGANIKYNWEDLDS
GFGAMGSVTYTSADVNNYGYKVGDADYTSLLVGPSYRFNDYLNAYVMIGAANGHIKDNWG
NSDNKTAFAYGAGIQLNPVENIAVNASYEHTSFSTDADSDVKAGT