Protein Info for GFF468 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 79 to 95 (17 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 324 (276 residues), 98 bits, see alignment E=2.8e-32

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 82% identity to vpe:Varpa_0277)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF468 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRNILLPVGAILAALLLFGLFVSFAGVDPVEVWVLLFKGAFGDWYSWQNTLQRAAPLMLT
ALCVAIPARAGLVVIGGEGALVLGGLASAALAHAVPLPAHLAGTVAVCLAGALAGALWIA
LAGWLRQFRGINETISSLLLAYVAIGLFKHLVEGPLRDPASLNKPSTPALDEGLLIGGIA
GSDVHWGLVIGIAVGLLAGLWLRLTPSGFSVQVVGGNPRAAQLVGLPATRLIIVACALGG
AAAGLAGAIEVAAVHTSANAALIAGYGYAGILVSFIARHHPFAVVPVAIVFGGFGAAGSL
LQRRLGLPDASVLLLQGIAFVLILASEALRDLDWKRVFDRLGQFGPSEPVPIVMPSPDTA
KGEPR