Protein Info for GFF4678 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Outer membrane vitamin B12 receptor BtuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07715: Plug" amino acids 69 to 172 (104 residues), 74 bits, see alignment E=1.3e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 70 to 713 (644 residues), 228.1 bits, see alignment E=1.2e-71 PF00593: TonB_dep_Rec_b-barrel" amino acids 243 to 683 (441 residues), 140.8 bits, see alignment E=1.3e-44

Best Hits

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>GFF4678 Outer membrane vitamin B12 receptor BtuB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKTVPRARVAALPLAIATAFPCLLSSATAWAQTSDTPSLATVTITEERGVATPLVKPSTA
GSRLELTPFETPASIAIVPGELVRALGTTSVIEAKTLAPGISSANSPGNGGNVLNARGFT
GTNSVKQLYNGLELNNAGGVVSFPFDPWNVERIEALYGPASVLYGAGAIGGAVNVVSKRP
DPTKSSHEIGLGIGSDNSLHEALSSTGPLGGGFSYRFDLSHRRSDNWVDRGQSDTLAVSA
ALRFDASPDLNFVLATDHGRQKPMHYLGTPVFNGAPVPGTETKNYNIADSDLFFQDKWIT
LDTEWKPSTGITVRNTLYNMEHNRRYRDVTVFTYQPTTATVRRSSYRDISYSLQTQRGVN
TYATFKGEVAGMKNEFLAGVQVERSFYDRFDNNRGGATVVDALNPVPGQYRQGWLGESIP
MYYLKLDKVGVFLENRLTLNQRWSVVAGLRSDSYRTEREDRQVNRITHGKVSGTSGSLGV
VFHPVQDVALYGQIATAQDPVTSLASIGANQQGFGLSQGRQVEIGLKQALWGGRLEWTLA
AYHLVKKDLLTANLANPTIQEQVGQQSSRGIEASVATRLGAWRFEANGTVLDPKFDDFKA
QVGSATRQLAGLVPMTVPKRAANVTAFWDFAPQWTARTSLQYVGQRFVNNTNTASLPSYT
VANAGVNWRAMRGLTLDLRVDNLFDKSYATQGSEVQWILGRPRTVWLSATYAF