Protein Info for GFF4678 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage minor tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06141: Phage_tail_U
  • amino acids 3 to 131 (129 residues), 208 bits, E=2.6e-66

Best Hits

Swiss-Prot: 58% identical to TTTP_BPN15: Tail tube terminator protein (gene) from Escherichia phage N15

KEGG orthology group: None (inferred from 99% identity to seh:SeHA_C1147)

Predicted SEED Role

"Phage minor tail protein"

Protein Sequence (133 amino acids)

>GFF4678 Phage minor tail protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTRHSAVRQAIIAALKKTDDGSTTFFDGRPVVVEEDELPAVAVYLSDAQYTGPEVDGDIW
SAVLHVEVFLKATAPDSALDEQMENRVYPALGSVAGLGDIIRTMSAQGYNYQRDDEMAMW
GSADLSYDITYSM