Protein Info for GFF4677 in Variovorax sp. SCN45

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 181 to 247 (67 residues), 47.8 bits, see alignment E=6.3e-17

Best Hits

KEGG orthology group: None (inferred from 86% identity to vap:Vapar_3568)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>GFF4677 Small-conductance mechanosensitive channel (Variovorax sp. SCN45)
MIKEILAHPWFGTWVAALIAVPLSLLAHRIGGLVLRRITRPAPTIHSMVVSCNSAARLVL
PLLALNVVWQGAPDDLHFIGNVRHLTGLLLIASTTWLAVRAISGFAEGVLAQNPSDVADN
LHARRVLTQTRVLARTAMTVVLVAGGAMMLMTFPGARQVGASLLASAGVIGIVAGLAAKP
VFSNLIAGLQIALAQPIRIDDVLVVEGEWGRVEEITGTFVVIKIWDERRLILPLTYFIEK
PFQNWTRHSSQLLGAVFIYADYGMPLAPLREEVERIVKSSSEWDGRFFNLRVTDATERTM
QIRVLCTAATSGLAFDLRCNVREGLIDFMQREYPQFLPKMRIESEGAQERQMPQPAQHA